PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0027800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 664aa    MW: 70644.4 Da    PI: 4.9998
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0027800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.81.7e-1302446491374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPil 91 
                      lv++L++cAeav+++++++a+al++++  l  ++g +m+++a+yf+eALa+r++r        ++p ++++   +++++ + l   f+e +P+l
  Spipo15G0027800 244 LVHTLMACAEAVQQDNFKAAEALVKQIGVLTMSQGGAMRKVATYFAEALARRIYR--------IRPGQDQS--LIDAAFEDILqmnFYESCPYL 327
                      689****************************************************........44444332..3333332222335******** PP

             GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                      kf+h+taNqaIlea++g++rvH+iDf+++qG QWpaL+qaLa Rp+gpps+R+Tg+g+p+++++++l+++g++La++Ae+++v+fe++ +va +
  Spipo15G0027800 328 KFAHFTANQAILEAFAGKSRVHVIDFSMKQGQQWPALMQALALRPGGPPSFRLTGIGPPQPDDSDALQQVGWKLAQLAESMHVEFEYRSFVAAS 421
                      ********************************************************************************************** PP

             GRAS 186 ledleleeLrvkp............................gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                      l+dle+ +L++ +                            +E+la+n+vl+lh++l++++++e+    vL +v+ l+Pk+v+vveqea+hn++
  Spipo15G0027800 422 LADLEPYMLELASsarsssssggsrrkgdsagggssgeeqeEEVLAINSVLELHKMLARPGAVEK----VLGTVRALRPKIVTVVEQEANHNGP 511
                      *********554444555555555566666666666667779***********************....************************* PP

             GRAS 252 sFlerflealeyysalfdsleak..............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                       F+erf eal+yys++fdsle                 ++e+ + +++ +++lg++i+nvvaceg er+erhet ++Wr r+e+aGF+pv++++
  Spipo15G0027800 512 VFVERFNEALHYYSTMFDSLEGCaapppsaaglsgaaDAAEAGQIHVMTEVYLGQQICNVVACEGPERTERHETIGQWRGRMEAAGFEPVHIGS 605
                      ********************8888999999998886433445889999********************************************** PP

             GRAS 332 kaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaWr
  Spipo15G0027800 606 NAFKQASMLLAVFAgGDGYRVEEKDGCLMLGWHTRPLITTSAWR 649
                      *******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.9E-3346123IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011298.8E-3146129No hitNo description
PROSITE profilePS5098562.909218628IPR005202Transcription factor GRAS
PfamPF035145.9E-128244649IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MKREYTDGRD CGGGAGGDMA QQQQQGFSGK NKMAMMMAEQ QDAGVDEHLA VLGYKVRSSD  60
MADVAQKLEQ LEMAMVSGAV VGGGGAPDDN SILTHLSSET VHYNPSDLST WLETMLSELN  120
APPAPSPTAK APSSSSSSSS TAADNPLRAP PAGPSFSRPP ALLPDFPVPS IAGIDFPGSG  180
RPSSDSDLHA IPGGRVMYGN SDSADTEPRD RKRLRTSPAA AAPPSPESPV QVVLVDSQET  240
GIRLVHTLMA CAEAVQQDNF KAAEALVKQI GVLTMSQGGA MRKVATYFAE ALARRIYRIR  300
PGQDQSLIDA AFEDILQMNF YESCPYLKFA HFTANQAILE AFAGKSRVHV IDFSMKQGQQ  360
WPALMQALAL RPGGPPSFRL TGIGPPQPDD SDALQQVGWK LAQLAESMHV EFEYRSFVAA  420
SLADLEPYML ELASSARSSS SSGGSRRKGD SAGGGSSGEE QEEEVLAINS VLELHKMLAR  480
PGAVEKVLGT VRALRPKIVT VVEQEANHNG PVFVERFNEA LHYYSTMFDS LEGCAAPPPS  540
AAGLSGAADA AEAGQIHVMT EVYLGQQICN VVACEGPERT ERHETIGQWR GRMEAAGFEP  600
VHIGSNAFKQ ASMLLAVFAG GDGYRVEEKD GCLMLGWHTR PLITTSAWRL ADSSPRSAAA  660
PPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-482446494375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926472.10.0PREDICTED: DELLA protein SLR1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA5BT980.0A5BT98_VITVI; Putative uncharacterized protein
STRINGVIT_14s0006g00640.t010.0(Vitis vinifera)
STRINGGRMZM2G024973_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein